PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015310-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family SRS
Protein Properties Length: 349aa    MW: 35996.8 Da    PI: 8.4299
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015310-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022182e-671332923153
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                    s++a+CqdCGnqakkdC+h+RCRtCCksrgfdC thvkstWvpaa+rrer+  +aaa++ a +s +++a k++r   +++++++s+t++s++++++
  NNU_015310-RA 133 STAATCQDCGNQAKKDCNHRRCRTCCKSRGFDCPTHVKSTWVPAARRRERHLSAAAAAAAAGSSGSTSAVKKPRLI-ASQTTTASHTSTSNTTPPR 227
                    56789*********************************************99999999999998899999999986.7888999999********* PP

         DUF702  99 eletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                    +++tss          lP +++++avf+cvrv++vddge e+aYq++v+igGhvfkG+LydqG++
  NNU_015310-RA 228 SFDTSSshqdasfretLPGQIRAPAVFKCVRVTAVDDGEGEYAYQAVVKIGGHVFKGFLYDQGVD 292
                    ****999********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.6E-62136292IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27137179IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.0E-30244291IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGMVGLRDVF VVAPASSFHH NQQHEPILSD HHHQINNSNA ATALGVGVGV GVIPLLTASC  60
LGPANVGIDD GDNMNSRSRG GGIHLWQNQQ PQNYLKKPML IDHNNSANLL SSSNNGACGG  120
TGSGGLGMTS TTSTAATCQD CGNQAKKDCN HRRCRTCCKS RGFDCPTHVK STWVPAARRR  180
ERHLSAAAAA AAAGSSGSTS AVKKPRLIAS QTTTASHTST SNTTPPRSFD TSSSHQDASF  240
RETLPGQIRA PAVFKCVRVT AVDDGEGEYA YQAVVKIGGH VFKGFLYDQG VDGRDGFPNI  300
SDLHLGGGSG GGGTRNGASS SSPILDPSDV YAASGGGLLG GTAYGNPIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010269431.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK94e-93LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLF6HA241e-147F6HA24_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g03450.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.26e-74Lateral root primordium (LRP) protein-related